PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0301s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 225aa    MW: 25417.4 Da    PI: 5.513
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0301s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN367.34.2e-211385103178
                          XXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S-- CS
                 EIN3 103 rngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGke 178
                            gpaa +kyqakn i++++++ ++ + s++h+l+elq+Ttl+SL salmqh d   r fple+ v+ +WWPtG+e
  Kalax.0301s0037.1.p  13 D-GPAAAAKYQAKNSIPGNHEGANS-AGSTPHTLQELQNTTLSSLFSALMQHYDQLTR-FPLEEEVTSSWWPTGEE 85 
                          4.9******************9988.9***************************7765.***************98 PP

2EIN343.57.4e-1485191228352
                          TTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3 228 erqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpses 317
                          e+q k+lqdkm+akes+++l+++ qee ++++++++s          + s ++k    g   +  +  + v+   +++++rkrk ++se 
  Kalax.0301s0037.1.p  85 EWQYKCLQDKMTAKESATWLAIIDQEETLARELYPDSF---------FPSYDTK----GFMTNP-SPYSFVDV--NVDIARKRK-PSSEL 157
                          89********************************9984.........3333333....222222.23344444..789999999.67777 PP

                          XXXXXX......XXXXXXX.XXXXXXXXXXXXXXX CS
                 EIN3 318 akvsskevsrtcqssqfrgsetelifadknsisqn 352
                          + v++++ ++t +s ++++se++l+f++  s++++
  Kalax.0301s0037.1.p 158 NWVMEQN-IYTSESLSCPYSESNLGFHNGISRDHH 191
                          7776665.6********************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048738.5E-191385No hitNo description
Gene3DG3DSA:1.10.3180.109.0E-143585IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167684.45E-1741114IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene3DG3DSA:1.10.3180.105.6E-986120IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MFTIIISGER FGDGPAAAAK YQAKNSIPGN HEGANSAGST PHTLQELQNT TLSSLFSALM  60
QHYDQLTRFP LEEEVTSSWW PTGEEWQYKC LQDKMTAKES ATWLAIIDQE ETLARELYPD  120
SFFPSYDTKG FMTNPSPYSF VDVNVDIARK RKPSSELNWV MEQNIYTSES LSCPYSESNL  180
GFHNGISRDH HLLSCPYKAY LLSSDPIMMH FHKGKSINFH QSIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-28391211134Protein ETHYLENE INSENSITIVE 3
4zds_B9e-28391211134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015893527.14e-63PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246062e-53EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0M4IZC27e-61A0A0M4IZC2_HEVBR; Ethylene-insensitive3/ethylene-insensitive3-like protein
TrEMBLA0A0R5PCZ55e-61A0A0R5PCZ5_CARPA; Ethylene insensitive 3b
STRINGPOPTR_0009s16080.13e-57(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-54EIL family protein